| Cat.No.: | EAb-3247 |
| Product Name: | Spt6 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect Spt6 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human Spt6 aa 1322-1419. |
| Immunogen Sequence: | RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTW KVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPM |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol |
| Applications: | IHC-P, ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q7KZ85 |
| Alternative Name: | emb 5 antibody/hSPT6 antibody/KIAA0162 antibody |
| Scientific Background: | Acts to stimulate transcriptional elongation by RNA polymerase II. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0089 | Recombinant Human SP2 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0161 | Human SP1 Knockout Cell Line 2bp deletion | Inquiry |
| CL-0169 | Human SP140L Knockout Cell Line | Inquiry |
| CL-0170 | Human SP100 Knockout Cell Line 20bp deletion | Inquiry |
| CL-0171 | Human SP110 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| SP1 | SP100 | SP110 | SP140 |
| SP140L | SP2 | SP3 | SP6 |
| SPDL1 | SPF30 | SPIN1 | SPOP |
| SPT16 | SPT3 | Spt6 | SPTY2D1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
