HIRA/HIR Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3239
Product Name:  HIRA/HIR Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect HIRA/HIR
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human HIRA/HIR aa 681-782.
Immunogen Sequence:  LKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSRLKCNREGKEW ETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSPILLPSPISTL HC
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  P54198
Alternative Name:  DGCR1 antibody/DiGeorge critical region gene 1 antibody/HIR antibody
Scientific Background:  Cooperates with ASF1A to promote replication-independent chromatin assembly. Required for the periodic repression of histone gene transcription during the cell cycle. Required for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.