HIRA/HIR Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3239
Product Name:  HIRA/HIR Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect HIRA/HIR
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human HIRA/HIR aa 681-782.
Immunogen Sequence:  LKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSRLKCNREGKEW ETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSPILLPSPISTL HC
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  P54198
Alternative Name:  DGCR1 antibody/DiGeorge critical region gene 1 antibody/HIR antibody
Scientific Background:  Cooperates with ASF1A to promote replication-independent chromatin assembly. Required for the periodic repression of histone gene transcription during the cell cycle. Required for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

  • Tel: 1-631-559-9269 / 1-516-512-3133
  • Fax: 1-631-938-8127
  • Email:
  • 45-1 Ramsey Road, Shirley, NY 11967, USA
  • Global Locations

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2025 Creative BioMart. All Rights Reserved.