| Cat.No.: | EAb-3173 |
| Product Name: | CDKA1/DOC1 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect CDKA1/DOC1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human CDKA1/ DOC1 aa 1-30. |
| Immunogen Sequence: | MSYKPNLAAHMPAAALNAAGSVHSPSTSMA |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol |
| Applications: | ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | O14519-1 |
| Alternative Name: | CDK2 A1 antibody/CDK2 associated protein 1 antibody/CDK2-associated protein 1 antibody |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0112 | Human CDKN1B Knockout Cell Line 10bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0118 | Recombinant Mouse CDK1 Cell Lysate | Inquiry |
| EL-0119 | Recombinant Human CDK1 Cell Lysate | Inquiry |
| EL-0209 | Recombinant Human CD1D & B2M Cell Lysate | Inquiry |
| EL-0210 | Recombinant Human CD1D Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| CD1D | CDA | CDC34 | CDK1 |
| CDK8 | CDK9 | CDKA1 | CDKN1B |
| CDX1 | CDY2A | CDYL | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
