| Cat.No.: | EAb-3171 |
| Product Name: | ZBTB38 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect ZBTB38 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human ZBTB38 aa 692-817. |
| Immunogen Sequence: | PVLSLSNSSENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNH RAFSDPAVSQSLKDDSKPEPDKVGRFASRPKSIKEKKKTTSHTRGEIPEE SNYVADPGGSLSKTTNIAEETSKIET |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS |
| Applications: | ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q8NAP3 |
| Alternative Name: | CIBZ antibody/FLJ22332 antibody/FLJ31131 antibody |
| Scientific Background: | Acts as a transcriptional activator. May be involved in the differentiation and/or survival of late postmitotic neurons. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0048 | Recombinant Human ZBTB33 Cell Lysate | Inquiry |
| EL-0110 | Recombinant Human ZBTB7A Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0223 | Human ZBTB33 Knockout Cell Line 46bp deletion | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0415 | Recombinant Human ZBTB4, His-tagged | Inquiry |
| PE-0466 | Recombinant Chicken ZBTB33 | Inquiry |
| Related Gene / Proteins | |||
| ZBED2 | ZBTB33 | ZBTB38 | ZBTB4 |
| ZBTB7A | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
