| Cat.No.: | EAb-3095 |
| Product Name: | Histone H1t2 Polyclonal Antibody (N-terminal) |
| Product Overview: | Rabbit polyclonal to detect Histone H1t2 - N-terminal |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human Histone H1t2 aa 1-94 (N terminal). |
| Immunogen Sequence: | MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPS RGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.2; 0.02% Sodium azide, 59% PBS, 40% Glycerol |
| Applications: | IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q75WM6 |
| Alternative Name: | H1 histone family member N testis specific antibody/H1FNT antibody/H1FNT_HUMAN antibody |
| Scientific Background: | Essential for normal spermatogenesis and male fertility. Required for proper cell restructuring and DNA condensation during the elongation phase of spermiogenesis. Involved in the histone-protamine transition of sperm chromatin and the subsequent production of functional sperm. Binds both double-stranded and single-stranded DNA, ATP and protamine-1. |
| Product Types | ||
| ◆ Nucleosomes | ||
| NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
| NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
| SP-0010 | Histone H4 peptide (1-21) | Inquiry |
| SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
| Related Gene / Proteins | |||
| HIC1 | HIF1A | HIF1AN | HINFP |
| HIPK1 | HIPK2 | HIRA | Histone |
| Histone H1 | Histone H2A | Histone H2B | Histone H3 |
| Histone H4 | HIV-1 reverse transcriptase | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
