| Cat.No.: | EAb-2958 |
| Product Name: | HDAC10 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect HDAC10 |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide within Human HDAC10 aa 540-590 conjugated to keyhole limpet haemocyanin. |
| Immunogen Sequence: | SMFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPH A |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein A purified |
| Appearance: | Liquid |
| Formulation: | 0.09% Sodium azide, 1% BSA, 50% Glycerol |
| Applications: | IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q969S8 |
| Alternative Name: | DKFZP761B039 antibody/HD 10 antibody/HD10 antibody |
| Scientific Background: | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0006 | Recombinant Human HDAC1 293 Cell Lysate | Inquiry |
| EL-0007 | Recombinant Human HDAC2 293 Cell Lysate | Inquiry |
| EL-0008 | Recombinant Human HDAC3 Cell Lysate | Inquiry |
| EL-0009 | Recombinant Human HDAC4 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0007 | Tubacin | Inquiry |
| Related Gene / Proteins | |||
| HDAC | HDAC1 | HDAC10 | HDAC11 |
| HDAC2 | HDAC3 | hdac4 | hdac5 |
| HDAC6 | hdac7 | HDAC8 | hdac9 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
