| Cat.No.: | EAb-2952 |
| Product Name: | KMT4/Dot1L Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect KMT4/Dot1L |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide within Human KMT4/ Dot1L aa 40-90 conjugated to keyhole limpet haemocyanin. |
| Immunogen Sequence: | TIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLW K |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein A purified |
| Appearance: | Liquid |
| Formulation: | 0.09% Sodium azide, 1% BSA, 50% Glycerol |
| Applications: | IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q8TEK3 |
| Alternative Name: | Disrupter of telomere silencing protein 1 antibody/DOT 1 antibody/DOT1 antibody |
| Scientific Background: | Histone methyltransferase. Methylates 'Lys-79' of histone H3. Nucleosomes are preferred as substrate compared to free histones. Binds to DNA. |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
