PRDM6 Polyclonal Antibody (C-terminal)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2947
Product Name:  PRDM6 Polyclonal Antibody (C-terminal)
Product Overview:  Rabbit polyclonal to detect PRDM6 - C-terminal
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human PRDM6 aa 356-405 (C terminal).
Immunogen Sequence:  FAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITE
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 2% Sucrose, PBS
Applications:  WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9NQX0-1
Alternative Name:  Gm92 antibody/PFM3 antibody/PR domain containing 6 antibody
Scientific Background:  Putative histone methyltransferase that acts as a transcriptional repressor of smooth muscle gene expression. Promotes the transition from differentiated to proliferative smooth muscle by suppressing differentiation and maintaining the proliferative potential of vascular smooth muscle cells. Also plays a role in endothelial cells by inhibiting endothelial cell proliferation, survival and differentiation. It is unclear whether it has histone methyltransferase activity in vivo. According to some authors, it does not act as a histone methyltransferase by itself and represses transcription by recruiting EHMT2/G9a. According to others, it possesses histone methyltransferase activity when associated with other proteins and specifically methylates 'Lys-20' of histone H4 in vitro. 'Lys-20' methylation represents a specific tag for epigenetic transcriptional repression.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.