| Cat.No.: | EAb-2883 |
| Product Name: | HMGB1 Monoclonal Antibody |
| Product Overview: | Mouse monoclonal to detect HMGB1 |
| Antibody Type: | Monoclonal |
| Immunogen: | Recombinant full length protein (GST-tag) corresponding to Human HMGB1 aa 1-215. |
| Immunogen Sequence: | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK TMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE EDEEDEDEEEDDDDE |
| Host: | Mouse |
| Isotype: | IgG1 |
| Purification: | Tissue culture supernatant |
| Appearance: | Liquid |
| Formulation: | pH: 7.4, PBS |
| Applications: | WB, IHC-P, ICC/IF, ELISA, Flow Cyt |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | P09429 |
| Alternative Name: | Amphoterin antibody/Chromosomal protein, nonhistone, HMG1 antibody/DKFZp686A04236 antibody |
| Scientific Background: | High mobility group (HMG) proteins 1 and 2 are ubiquitous non-histone components of chromatin. Evidence suggests that the binding of HMG proteins to DNA induces alterations in the DNA architecture including DNA bending and unwinding of the helix. HMG proteins synergize with Oct-2, members of the NF˚B family, ATF-2 and c-Jun to activate transcription. Other studies indicate that phosphorylation of HMG protein is required to stimulate the transcriptional activity of the protein. Human HMG-1 and HMG-2 both contain two DNA-binding domains, termed HMG boxes. HMG proteins bind single-stranded DNA but induce conformational changes in double-stranded DNA alone. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
