PARP6 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2851
Product Name:  PARP6 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect PARP6
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human PARP6 aa 431-480 (C terminal).
Immunogen Sequence:  KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 2% Sucrose, PBS
Applications:  WB, IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q2NL67
Alternative Name:  1700119G14Rik antibody/2310028P13Rik antibody/3110038K10Rik antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.