Cat.No.: | EAb-2837 |
Product Name: | USP35 Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect USP35 |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment corresponding to Human USP35 aa 602-680. |
Immunogen Sequence: | PPERCRRRRLGSVMRPTEDITARELPPPTSAQGPGRVGPRRQRKHCITED TPPTSLYIEGLDSKEAGGQSSQEERIERE |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS |
Applications: | ICC/IF, IHC-P |
Species Reactivity: | Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q9P2H5 |
Alternative Name: | Deubiquitinating enzyme 35 antibody/Gm1088 antibody/Gm493 antibody |
Product Types | ||
◆ Antibodies | ||
EAb-0006 | USP3 Polyclonal Antibody | Inquiry |
EAb-0007 | USP25 Polyclonal Antibody | Inquiry |
EAb-0008 | USP2 Polyclonal Antibody | Inquiry |
EAb-0009 | USP1 Polyclonal Antibody | Inquiry |
EAb-0010 | USP7 Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
USF1 | USP1 | USP10 | USP11 |
USP12 | USP13 | USP14 | USP15 |
USP16 | USP17L11 | USP17L12 | USP17L13 |
USP17L15 | USP17L17 | USP17L1P | USP17L2 |
USP17L22 | USP17L28 | USP17L3 | USP17L5 More > |
USP17L8 | USP18 | USP19 | USP2 |
USP20 | USP21 | USP22 | USP24 |
USP25 | USP26 | USP27X | USP28 |
USP29 | USP3 | USP30 | USP31 |
USP32 | USP33 | USP34 | USP35 |
USP36 | USP37 | USP38 | USP40 |
USP42 | USP43 | USP44 | USP45 |
USP46 | USP47 | USP48 | USP49 |
USP5 | USP53 | USP54 | USP6 |
USP6NL | USP7 | USP8 | USP9X |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools