Cat.No.: | EAb-2767 |
Product Name: | KAT5/Tip60 Polyclonal Antibody |
Product Overview: | Mouse polyclonal to detect KAT5/Tip60 |
Antibody Type: | Polyclonal |
Immunogen: | Full length protein corresponding to Human KAT5/ Tip60 aa 1-513. |
Immunogen Sequence: | MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDF NKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQ ASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRK VEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQ DSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPY PQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFH IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTG TPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSI KKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCL HFTPKDWSKRGKW |
Host: | Mouse |
Isotype: | IgG |
Purification: | Protein A purified |
Appearance: | Liquid |
Formulation: | pH: 7.2, 100% PBS |
Applications: | WB |
Species Reactivity: | Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | NP_006379.2 |
Alternative Name: | 60 kDa Tat interactive protein antibody/60 kDa Tat-interactive protein antibody/cPLA(2) interacting protein antibody |
Scientific Background: | Catalytic subunit of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome-DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Directly acetylates and activates ATM. In case of HIV-1 infection, interaction with the viral Tat protein leads to KAT5 polyubiquitination and targets it to degradation. |
Product Types | ||
◆ Antibodies | ||
EAb-0014 | TIP60 Polyclonal Antibody | Inquiry |
EAb-0015 | TIP60 Polyclonal Antibody | Inquiry |
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0073 | Anacardic Acid | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
Related Gene / Proteins | |||
Kaiso | KANSL2 | KAP1 | KAT13A |
KAT13D | KAT2A | KAT2B | KAT4 |
KAT5 | KAT6A | KAT6B | KAT7 |
KAT8 | KAT9 | TIAL1 | TIEG1 |
TIF1 | TIGD4 | TIGD5 | TIP49A More > |
TIP49B | TIP60 | TIS11D |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools