KAT6B/MORF Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2728
Product Name:  KAT6B/MORF Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect KAT6B/MORF
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human KAT6B/ MORF aa 1186-1318.
Immunogen Sequence:  KPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGS KDNPEPLKCKQVWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPMEPDE QVTVEEQKETSEGKTSPSPIRIEEEVKETGEAL
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  IHC-P, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q8WYB5
Alternative Name:  DKFZp313G1618 antibody/FLJ90335 antibody/Histone acetyltransferase MORF antibody
Scientific Background:  Histone acetyltransferase which may be involved in both positive and negative regulation of transcription. Required for RUNX2-dependent transcriptional activation. May be involved in cerebral cortex development. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.