Cat.No.: | EAb-2728 |
Product Name: | KAT6B/MORF Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect KAT6B/MORF |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment corresponding to Human KAT6B/ MORF aa 1186-1318. |
Immunogen Sequence: | KPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGS KDNPEPLKCKQVWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPMEPDE QVTVEEQKETSEGKTSPSPIRIEEEVKETGEAL |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS |
Applications: | IHC-P, ICC/IF |
Species Reactivity: | Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q8WYB5 |
Alternative Name: | DKFZp313G1618 antibody/FLJ90335 antibody/Histone acetyltransferase MORF antibody |
Scientific Background: | Histone acetyltransferase which may be involved in both positive and negative regulation of transcription. Required for RUNX2-dependent transcriptional activation. May be involved in cerebral cortex development. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0073 | Anacardic Acid | Inquiry |
◆ Antibodies | ||
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
◆ Extracts & Lysates | ||
EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
Kaiso | KANSL2 | KAP1 | KAT13A |
KAT13D | KAT2A | KAT2B | KAT4 |
KAT5 | KAT6A | KAT6B | KAT7 |
KAT8 | KAT9 | MOF | MORC2 |
MORC3 | MORF | MORF4L2 | MOZ |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools