Cat.No.: | EAb-2715 |
Product Name: | SUZ12 Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect SUZ12 |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment corresponding to Human SUZ12 aa 131-305. |
Immunogen Sequence: | TFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSL AVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEEL PARRKRNREDGEKTFVAQMTVFDKN |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Protein G purified |
Appearance: | Liquid |
Formulation: | pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS |
Applications: | IHC-P, WB, ICC/IF |
Species Reactivity: | Rat, Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q15022 |
Alternative Name: | ChET 9 protein antibody/CHET9 antibody/Chromatin precipitated E2F target 9 protein antibody |
Scientific Background: | Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A. |
Product Types | ||
◆ Antibodies | ||
EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0100 | Chaetocin | Inquiry |
◆ Extracts & Lysates | ||
EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
SUDS3 | SUMO | SUMO1 | SUMO2 |
SUMO3 | SUN1 | Surf6 | suv39h1 |
SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
SUZ12 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools