SUZ12 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2715
Product Name:  SUZ12 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect SUZ12
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human SUZ12 aa 131-305.
Immunogen Sequence:  TFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSL AVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEEL PARRKRNREDGEKTFVAQMTVFDKN
Host:  Rabbit
Isotype:  IgG
Purification:  Protein G purified
Appearance:  Liquid
Formulation:  pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS
Applications:  IHC-P, WB, ICC/IF
Species Reactivity:  Rat, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q15022
Alternative Name:  ChET 9 protein antibody/CHET9 antibody/Chromatin precipitated E2F target 9 protein antibody
Scientific Background:  Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.