Cat.No.: | EAb-2698 |
Product Name: | KDM5C/Jarid1C/SMCX Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect KDM5C/Jarid1C/SMCX |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment corresponding to Human KDM5C/ Jarid1C/ SMCX aa 1001-1330. Isoform 4. |
Immunogen Sequence: | LRQLELQVLTAHSWREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSR WMEKELGLYKSDTELLGLSAQDLRDPGSVIVAFKEGEQKEKEGILQLRRT NSAKPSPLASSSTASSTTSICVCGQVLAGAGALQCDLCQDWFHGRCVSVP RLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQR LPVRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQRLQA EPRPEEPPNYPAAPASDPLREGSGKDMPKVQGLLENGDSVTSPEKVAPEE GSDLELLSSLLPQLTGPVLELPEATRAPLE |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Whole antiserum |
Appearance: | Liquid |
Applications: | ICC/IF, WB, IP |
Species Reactivity: | Mouse, Rat, Chicken, Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | P41229-4 |
Alternative Name: | DXS1272E antibody/Histone demethylase JARID1C antibody/JARID1C antibody |
Scientific Background: | Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0002 | AT9283 | Inquiry |
◆ Cell Lines | ||
CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0019 | SMARCA4 Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0063 | Recombinant Human SMARCC2 293 Cell Lysate | Inquiry |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools