| Cat.No.: | EAb-2684 |
| Product Name: | Jarid2 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect Jarid2 |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide within Human Jarid2 aa 1-100 (N terminal). |
| Immunogen Sequence: | MSKERPKRNIIQKKYDDSDGIPWSEERVVRKVLYLSLKEFKNSQKRQHAE GIAGSLKTVNGLLGNDQSKGLGPASEQSENEKDDASQVSSTSNDVSSSDF |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein A purified |
| Appearance: | Liquid |
| Formulation: | 0.05% Sodium azide, 0.88% Sodium chloride, 99% Tris glycine |
| Applications: | WB, ChIP, ICC/IF |
| Species Reactivity: | Mouse, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q92833 |
| Alternative Name: | JARD2 antibody/JARD2_HUMAN antibody/JARID2 antibody |
| Scientific Background: | Regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis. Acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes. Binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells. Does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases. Also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5. Participates in the negative regulation of cell proliferation signaling. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0002 | AT9283 | Inquiry |
| ◆ Cell Lines | ||
| CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
| CL-0081 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0079 | JARID2 Polyclonal Antibody | Inquiry |
| EAb-0080 | JARID1C Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| JADE1 | JAK | JAK1 | JAK2 |
| JAK3 | JAKMIP1 | JARID | JARID1 |
| JARID1A | JARID1B | JARID1C | JARID2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
