KMT1B/SUV39H2 Polyclonal Antibody (C-terminal)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2653
Product Name:  KMT1B/SUV39H2 Polyclonal Antibody (C-terminal)
Product Overview:  Rabbit polyclonal to detect KMT1B/SUV39H2 - C-terminal
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human KMT1B/ SUV39H2 aa 201-410 (C terminal).
Immunogen Sequence:  CCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQY SLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTR LPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKC GAVTCRGYLN
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.3; 0.02% Sodium azide, 50% Glycerol, 49% PBS
Applications:  IHC-P, WB
Species Reactivity:  Mouse, Rat, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9H5I1
Alternative Name:  FLJ23414 antibody/H3 K9 HMTase 2 antibody/H3-K9-HMTase 2 antibody
Scientific Background:  Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher order chromatin organization during spermatogenesis.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.