| Cat.No.: | EAb-2610 |
| Product Name: | ING2 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect ING2 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human ING2 aa 1-90. |
| Immunogen Sequence: | MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLR ELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRAL |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol |
| Applications: | WB, ICC/IF, IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9H160 |
| Alternative Name: | ING 1 like tumor suppressor protein antibody/ING 1L antibody/ING 2 antibody |
| Scientific Background: | Seems to be involved in p53/TP53 activation and p53/TP53-dependent apoptotic pathways, probably by enhancing acetylation of p53/TP53. Component of a mSin3A-like corepressor complex, which is probably involved in deacetylation of nucleosomal histones. ING2 activity seems to be modulated by binding to phosphoinositides (PtdInsPs). |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0182 | Recombinant Human ING5 293 Cell Lysate | Inquiry |
| EL-0189 | Recombinant Human ING3 293 Cell Lysate | Inquiry |
| EL-0196 | Recombinant Human ING4 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0317 | ING4 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0403 | Human INSL6 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| ING1 | ING2 | ING3 | ING4 |
| ING5 | INHAT-1 | INHAT-2 | Ini1 |
| INSL6 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
