| Cat.No.: | EAb-2567 |
| Product Name: | KAT4/TBP Associated Factor 1 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect KAT4/TBP Associated Factor 1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide within Human KAT4/ TBP Associated Factor 1 aa 1823-1872 (C terminal). |
| Immunogen Sequence: | YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | 0.09% Sodium azide, 2% Sucrose, PBS |
| Applications: | IHC-P, ELISA, WB, ChIP |
| Species Reactivity: | Mouse, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | P21675 |
| Alternative Name: | BA2R antibody/CCG1 antibody/CCGS antibody |
| Scientific Background: | Largest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity. Essential for progression of the G1 phase of the cell cycle. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0015 | Hesperadin | Inquiry |
| BSM-0073 | Anacardic Acid | Inquiry |
| ◆ Antibodies | ||
| EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
| CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
| Related Gene / Proteins | |||
| Kaiso | KANSL2 | KAP1 | KAT13A |
| KAT13D | KAT2A | KAT2B | KAT4 |
| KAT5 | KAT6A | KAT6B | KAT7 |
| KAT8 | KAT9 | TbAUK1 | TBL1XR1 |
| TBP | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
