| Cat.No.: | EAb-2470 |
| Product Name: | HMGB4 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect HMGB4 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant full length protein corresponding to Human HMGB4 aa 1-186. (With tag). |
| Immunogen Sequence: | MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPSTYVGFKEFSRKCSEKWR SISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQAPRRPPSSF LLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLR AKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.30; 0.05% Sodium azide, 49% PBS, 50% Glycerol (PBS without Mg2+ and Ca2+) |
| Applications: | WB |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q8WW32 |
| Alternative Name: | High mobility group box 4 antibody/High mobility group protein B4 antibody/HMG2 like antibody |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
