Cat.No.: | EAb-2425 |
Product Name: | MSI2 Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect MSI2 |
Antibody Type: | Polyclonal |
Immunogen: | Synthetic peptide within Human MSI2 aa 37-86 (N terminal). |
Immunogen Sequence: | LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Protein A purified |
Appearance: | Liquid |
Formulation: | 0.09% Sodium azide, 2% Sucrose, PBS |
Applications: | ELISA, IHC-Fr, WB, IHC-P |
Species Reactivity: | Mouse, Human, Apteronotus leptorhynchus |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q96DH6 |
Alternative Name: | FLJ36569 antibody/MGC3245 antibody/Msi2 antibody |
Scientific Background: | RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0104 | Recombinant Human MSL1 Lysate | Inquiry |
EL-0193 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
EL-0194 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
EL-0218 | Recombinant Human MSH6 293 Cell Lysate | Inquiry |
EL-0227 | Recombinant Human MSL2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
MS4A7 | MSH2 | MSH3 | MSH5 |
MSH6 | MSI2 | MSL1 | MSL2 |
MSL3 | MSP58 | MST1 | MSY2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools