| Cat.No.: | EAb-2406 |
| Product Name: | WDR5 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect WDR5 |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide within Human WDR5 aa 50-100. |
| Immunogen Sequence: | SVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS N |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | 0.09% Sodium azide, 99% Tris buffered saline, 0.1% BSA |
| Applications: | IHC-P, ICC/IF |
| Species Reactivity: | Mouse, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | NP_060058.1; P61964 |
| Alternative Name: | 2410008O07Rik antibody/AA408785 antibody/AA960360 antibody |
| Scientific Background: | Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0005 | WDR5 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0052 | Recombinant Human WDTC1 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0187 | OICR-9429 | Inquiry |
| BSM-0256 | WDR5 0103 | Inquiry |
| BSM-0335 | MM-102 | Inquiry |
| Related Gene / Proteins | |||
| WDHD1 | WDR4 | WDR5 | WDR77 |
| WDR82 | WDTC1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
