Cat.No.: | EAb-2405 |
Product Name: | EHD2 Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect EHD2 |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment corresponding to Human EHD2 aa 401-543. |
Immunogen Sequence: | ELESTEVGVQGGAFEGTHMGPFVERGPDEAMEDGEEGSDDEAEWVVTKDK SKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGM LDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Protein G purified |
Appearance: | Liquid |
Formulation: | pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS |
Applications: | WB, IHC-P, ICC/IF |
Species Reactivity: | Mouse, Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q9NZN4 |
Alternative Name: | EH domain containing 2 antibody/EH domain containing 3 antibody/EH domain containing protein 2 antibody |
Scientific Background: | Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0025 | BIX01294 (hydrochloride hydrate) | Inquiry |
BSM-0026 | UNC0224 | Inquiry |
BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
◆ Cell Lines | ||
CL-0059 | Human EHMT1 Knockout Cell Line 7bp deletion | Inquiry |
CL-0060 | Human EHMT2 Knockout Cell Line 34bp deletion | Inquiry |
Related Gene / Proteins | |||
EHD2 | EHMT1 | EHMT2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools