| Cat.No.: | EAb-2402 |
| Product Name: | HP1-alpha Monoclonal Antibody (3A11F8) |
| Product Overview: | Mouse monoclonal (3A11F8) to detect HP1 alpha |
| Antibody Type: | Monoclonal |
| Clone Designation: | 3A11F8 |
| Immunogen: | Recombinant full length protein corresponding to Human HP1 alpha aa 1-191. Expressed in E. coli. |
| Immunogen Sequence: | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNT WEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
| Host: | Mouse |
| Isotype: | IgG1 |
| Purification: | Protein G purified |
| Appearance: | Liquid |
| Formulation: | 0.05% Sodium azide, PBS |
| Applications: | WB, Flow Cyt, ICC/IF |
| Species Reactivity: | Mouse, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | P45973 |
| Alternative Name: | Antigen p25 antibody/CBX5 antibody/CBX5_HUMAN antibody |
| Scientific Background: | Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0051 | Human CBX1 Knockout Cell Line 32bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0082 | HP1α, β and γ Polyclonal Antibody | Inquiry |
| EAb-0083 | HP1α Polyclonal Antibody | Inquiry |
| EAb-0149 | CBX1 Polyclonal Antibody | Inquiry |
| EAb-0677 | CBX1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HP1 | HP1BP3 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
