| Cat.No.: | PE-2930 |
| Product Name: | Recombinant Human p150 CAF1/CAF protein |
| Background: | Core component of the CAF-1 complex, a complex thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer. CHAF1A binds to histones H3 and H4. It may play a role in heterochromatin maintenance in proliferating cells by bringing newly synthesized cbx proteins to heterochromatic DNA replication foci (By similarity). The CCR4-NOT complex functions as general transcription regulation complex. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | CAF/CAF 1/CAF 1 subunit A |
| Tag: | GST |
| Amino Acid Sequence: | CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEA SLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT |
| Sequence Similarities: | Belongs to the CHAF1A family. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Protein Length: | Protein fragment; 21 to 120 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0008 | PRMT4 peptide substrate, Biotin-labeled | Inquiry |
| ◆ Cell Lines | ||
| CL-0050 | Human CARM1 Knockout Cell Line 8bp deletion | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0123 | Ellagic acid | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0134 | Recombinant Human CARM1 293 Cell Lysate | Inquiry |
| EL-0148 | Recombinant Human CAMTA2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| CABIN1 | CAF1 | CAMKIV | CAMTA2 |
| CAPNS2 | CARHSP1 | CARM1 | CASC3 |
| CASP | CASP1 | CASP3 | p100 |
| p105 | p120 | p150 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
