Cat.No.: | PE-2877 |
Product Name: | Recombinant Human CUG-BP1 protein |
Background: | RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Activates SM exon 5 inclusion by antagonizing the repressive effect of PTB. Promotes exclusion of exon 11 of the INSR pre-mRNA. Inhibits, together with HNRNPH1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Increases translation and controls the choice of translation initiation codon of CEBPB mRNA. Increases mRNA translation of CEBPB in aging liver (By similarity). Increases translation of CDKN1A mRNA by antagonizing the repressive effect of CALR3. Mediates rapid cytoplasmic mRNA deadenylation. Recruits the deadenylase PARN to the poly(A) tail of EDEN-containing mRNAs to promote their deadenylation. Required for completion of spermatogenesis (By similarity). Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK and to Bruno response elements (BREs). Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. Binds to AU-rich sequences (AREs or EDEN-like) localized in the 3'-UTR of JUN and FOS mRNAs. Binds to the IR RNA. Binds to the 5'-region of CDKN1A and CEBPB mRNAs. Binds with the 5'-region of CEBPB mRNA in aging liver. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | 50 kDa Nuclear polyadenylated RNA binding protein/50 kDa nuclear polyadenylated RNA-binding protein/Bruno like 2 |
Tag: | GST |
Amino Acid Sequence: | MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRD RSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE KNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGC AFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQ LQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMG GLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSS SSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANL FIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPV SAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY |
Sequence Similarities: | Belongs to the CELF/BRUNOL family.Contains 3 RRM (RNA recognition motif) domains. |
Expression System: | Wheat germ |
Post Translational Modifications: | Phosphorylated. Its phosphorylation status increases in senescent cells. |
Protein Length: | Full length protein; 1 to 483 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0383 | CUEDC2 Polyclonal Antibody | Inquiry |
EAb-1418 | CUEDC2 Polyclonal Antibody, HRP Conjugated | Inquiry |
EAb-1419 | CUEDC2 Polyclonal Antibody, FITC Conjugated | Inquiry |
EAb-1420 | CUEDC2 Polyclonal Antibody, Biotin Conjugated | Inquiry |
EAb-1422 | CUEDC2 Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
CUEDC2 | CUG-BP1 | CUL4B |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools