Recombinant Human Elav-type RNA-binding protein ETR3


  • Specification
  • Related Products
Cat.No.:  PE-2873
Product Name:  Recombinant Human Elav-type RNA-binding protein ETR3
Background:  RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in embryonic, but not adult, skeletal muscle. Activates TNNT2 exon 5 inclusion by antagonizing the repressive effect of PTB. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Promotes inclusion of exonS 21 and exclusion of exon 5 of the NMDA receptor R1 pre-mRNA. Involved in the apoB RNA editing activity. Increases COX2 mRNA stability and inhibits COX2 mRNA translation in epithelial cells after radiation injury (By similarity). Modulates the cellular apoptosis program by regulating COX2-mediated prostaglandin E2 (PGE2) expression (By similarity). Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK. Binds to the muscle-specific splicing enhancer (MSE) intronic sites flanking the TNNT2 alternative exon 5. Binds preferentially to UG-rich sequences, in particular UG repeat and UGUU motifs. Binds to apoB mRNA, specifically to AU-rich sequences located immediatly upstream of the edited cytidine. Binds AU-rich sequences in the 3'-UTR of COX2 mRNA (By similarity). Binds to an intronic RNA element responsible for the silencing of exon 21 splicing (By similarity). Binds to (CUG)n repeats.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Bruno-like protein 3/BRUNOL3/Cardiac elav type RNA binding protein
Tag:  GST
Amino Acid Sequence:  MTVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKE LKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHN IKTLPGMHH
Sequence Similarities:  Belongs to the CELF/BRUNOL family.Contains 3 RRM (RNA recognition motif) domains.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1 to 109
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Extracts & Lysates
EL-0105 Recombinant Human ETS1 293 Cell Lysate Inquiry
◆ Antibodies
EAb-0139 ETO Polyclonal Antibody Inquiry
EAb-0195 ERM/ ETV5 Polyclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-0804 Recombinant Human ETS1 Inquiry
PE-0805 Recombinant Human ETS1 Inquiry
Related Gene / Proteins
ETO ETR3 ETS1 ETV5

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.