| Cat.No.: | PE-2854 |
| Product Name: | Recombinant Human SCYL1 protein |
| Background: | Regulates COPI-mediated retrograde traffic. Has no detectable kinase activity in vitro.Isoform 6 acts as transcriptional activator. It binds to three different types of GC-rich DNA binding sites (box-A, -B and -C) in the beta-polymerase promoter region. It also binds to the TERT promoter region. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Coated vesicle associated kinase of 90 kDa/Coated vesicle-associated kinase of 90 kDa/CVAK90 |
| Tag: | GST |
| Amino Acid Sequence: | DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPE SSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP |
| Sequence Similarities: | Belongs to the protein kinase superfamily.Contains 3 HEAT repeats.Contains 1 protein kinase domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 373 to 472 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0148 | Human SCFD2 Knockout Cell Line 7bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0179 | SCP3 Polyclonal Antibody | Inquiry |
| EAb-0180 | SCP2 Polyclonal Antibody | Inquiry |
| EAb-0806 | SCMH1 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-0807 | SCMH1 Polyclonal Antibody, FITC Conjugated | Inquiry |
| Related Gene / Proteins | |||
| SCFD2 | SCMH1 | SCML2 | SCP2 |
| SCP3 | SCYL1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
