| Cat.No.: | PE-2842 |
| Product Name: | Recombinant Human Cyclophilin E protein |
| Background: | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 35 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Expressed in E.coli as inclusion bodies, refolded, chromatographically purified and sterile filtered. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituent: 0.32% Tris HClNote: Buffer also contains a proprietary formulation of NaCl, KCl, EDTA, Arginine, DTT and Glycerol. |
| Accession#: | Q9UNP9 |
| Alternative Names: | Ab1-210/Cyclophilin 33/Cyclophilin E |
| Tag: | T7 |
| Amino Acid Sequence: | MASMTGGQQMGRGEFMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDI QIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPM RIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKK ARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFK GSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLS MANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKD GKPKQKVIIADCGEYV |
| Sequence Similarities: | Belongs to the cyclophilin-type PPIase family. PPIase E subfamily.Contains 1 PPIase cyclophilin-type domain.Contains 1 RRM (RNA recognition motif) domain. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 301 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0037 | Human CYBRD1 Knockout Cell Line | Inquiry |
| CL-0284 | Human CYLD Knockout Cell Line 172bp insertion | Inquiry |
| CL-0490 | Human CYBRD1 Knockout Cell Line | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0265 | Posaconazole | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2836 | Recombinant Human Cyclophilin E protein | Inquiry |
| Related Gene / Proteins | |||
| CYBRD1 | Cyclophilin | CYLD | CYP51A1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
