| Cat.No.: | PE-2819 |
| Product Name: | Recombinant Human NIP7 protein |
| Background: | Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Lyophilised |
| Molecular Weight: | 20 kDa |
| Purity: | > 95 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8; Constituents: 0.58% Sodium chloride, 99% Tris-HCl buffer |
| Accession#: | Q9Y221-1 |
| Alternative Names: | 60S ribosome subunit biogenesis protein NIP7 homolog/CGI 37/CGI37 |
| Tag: | His |
| Amino Acid Sequence: | MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEK IMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIK PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST QDCRKVDPMAIVVFHQADIGEYVRHEETLT |
| Sequence Similarities: | Belongs to the NIP7 family.Contains 1 PUA domain. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 180 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0192 | Human NIPA1 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0550 | Recombinant Human NIPBL, GST-tagged | Inquiry |
| PE-0551 | Recombinant Mouse NIPBL Protein | Inquiry |
| PE-2465 | Recombinant Human NIPP1 protein | Inquiry |
| PE-2622 | Recombinant Human NIPP1 protein | Inquiry |
| Related Gene / Proteins | |||
| NIP7 | NIPA1 | NIPBL | NIPP1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
