Cat.No.: | PE-2760 |
Product Name: | Recombinant Human SSBP4 protein |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | Single stranded DNA binding protein 4/Single-stranded DNA-binding protein 4/SSBP4 |
Tag: | GST |
Amino Acid Sequence: | PNAPMMGPHGQPFMSPRFPGGPRPTLRMPSQPPAGLPGSQPLLPGAMEPS PRAQGHPSMGGPMQRVTPPRGMASVGPQSYGGGMRPPPNSLAGPGLPAMN MGPGVRGPWA |
Sequence Similarities: | Contains 1 LisH domain. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 135 to 244 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0067 | Recombinant Human SSRP1 293 Cell Lysate | Inquiry |
◆ Proteins & Enzymes | ||
PE-0574 | Recombinant Human SSRP1, His-tagged | Inquiry |
PE-0575 | Recombinant Chicken SSRP1 | Inquiry |
PE-0576 | Recombinant Rat SSRP1 Protein | Inquiry |
PE-0577 | Recombinant Rhesus monkey SSRP1 Protein, His-tagged | Inquiry |
Related Gene / Proteins | |||
SSBP4 | SSRP1 | Ssu72 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools