| Cat.No.: | PE-2754 |
| Product Name: | Recombinant Human TCF7L1 protein |
| Background: | Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. Necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis (By similarity). Down-regulates NQO1, leading to increased mitomycin c resistance. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | bHLHb21/HMG box transcription factor/HMG box transcription factor 3 |
| Tag: | GST |
| Amino Acid Sequence: | PAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQ PPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKS |
| Sequence Similarities: | Belongs to the TCF/LEF family.Contains 1 HMG box DNA-binding domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 489 to 586 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0079 | Recombinant Human TCF21 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0664 | Recombinant Chicken TCF21 | Inquiry |
| PE-0665 | Recombinant Zebrafish TCF21 | Inquiry |
| PE-0666 | Recombinant Mouse TCF21 Protein | Inquiry |
| PE-0667 | Recombinant Rhesus monkey TCF21 Protein, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| TCF21 | TCF4 | TCF7 | TCF7L1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
