Cat.No.: | PE-2753 |
Product Name: | Recombinant Human THAP11 protein |
Background: | Transcriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. Sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | CTG B43a/CTG B45d/HRIHFB2206 |
Tag: | GST |
Amino Acid Sequence: | MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFS TFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGV |
Sequence Similarities: | Belongs to the THAP11 family.Contains 1 THAP-type zinc finger. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 1 to 85 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0189 | Human THBS3 Knockout Cell Line | Inquiry |
◆ Proteins & Enzymes | ||
PE-2128 | Recombinant Human THAP7 protein (denatured) | Inquiry |
PE-2257 | Recombinant Human THAP7 protein | Inquiry |
PE-2750 | Recombinant Human THAP8 protein | Inquiry |
PE-2751 | Recombinant Human THAP6 protein | Inquiry |
Related Gene / Proteins | |||
THAP1 | THAP11 | THAP2 | THAP6 |
THAP7 | THAP8 | THBS3 | THRβ |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools