| Cat.No.: | PE-2753 |
| Product Name: | Recombinant Human THAP11 protein |
| Background: | Transcriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. Sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | CTG B43a/CTG B45d/HRIHFB2206 |
| Tag: | GST |
| Amino Acid Sequence: | MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFS TFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGV |
| Sequence Similarities: | Belongs to the THAP11 family.Contains 1 THAP-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1 to 85 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0189 | Human THBS3 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2128 | Recombinant Human THAP7 protein (denatured) | Inquiry |
| PE-2257 | Recombinant Human THAP7 protein | Inquiry |
| PE-2750 | Recombinant Human THAP8 protein | Inquiry |
| PE-2751 | Recombinant Human THAP6 protein | Inquiry |
| Related Gene / Proteins | |||
| THAP1 | THAP11 | THAP2 | THAP6 |
| THAP7 | THAP8 | THBS3 | THRβ |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
