| Cat.No.: | PE-2709 |
| Product Name: | Recombinant Human PRIM2 protein |
| Background: | PRIM2 synthesizes small ribonucleotide primers for the initiation of DNA replication. The eukaryotic primase is a heterodimer of a small and a large subunit, p49 and p58 respectively. These two subunits purify as a complex tightly bound to DNA polymerase alpha. This tight association implicates polymerase alpha as the lagging-strand DNA polymerase in replication. Uniquely, primases are able to synthesize nucleotides de novo on a template by the formation of an initial dinucleotide. PRIM2 initiates synthesis with a triphosphate purine moiety at the 5'-end. After synthesis of 7-10 ribonucleotides, the primer template is translocated intramolecularly to the active site of the DNA polymerase alpha subunit. The p49 subunit of PRIM2 contains the catalytic active site. The human primase subunits are 90% identical in amino acid sequence to the mouse homologs. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | dJ422B11.1.1/DNA Primase/DNA primase 58kDa subunit |
| Tag: | GST |
| Amino Acid Sequence: | MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRV KLLKSVENLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDH ISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQ FEAVSIFL |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 158 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| BSM-0047 | SGC707 | Inquiry |
| ◆ Antibodies | ||
| EAb-0048 | PRMT6 Polyclonal Antibody | Inquiry |
| EAb-0049 | PRMT7 Polyclonal Antibody | Inquiry |
| EAb-0050 | PRMT1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| Pr-SET7 | PRC1 | PRC2 | PRDM1 |
| PRDM10 | PRDM11 | PRDM12 | PRDM13 |
| PRDM14 | PRDM15 | PRDM16 | PRDM17 |
| PRDM2 | PRDM3 | PRDM4 | PRDM5 |
| PRDM6 | PRDM7 | PRDM8 | PRDM9 More > |
| PREP1 | PRIM2 | PRKAA2 | PRKCA |
| PRKCB | PRKCE | PRKDC | PRKRIP1 |
| PRMT | prmt1 | PRMT2 | PRMT3 |
| PRMT5 | prmt6 | PRMT7 | PRMT8 |
| PRMT9 | Progerin | Protamine 2 | Prox1 |
| PRPF31 | PRPF40A | PRSS12 | PRSS55 |
| PRTFDC1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
