| Cat.No.: | PE-2622 |
| Product Name: | Recombinant Human NIPP1 protein |
| Background: | Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing. |
| Applications: | Western blot; SDS-PAGE; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | Q12972 |
| Alternative Names: | Activator of RNA decay/ARD 1/ARD-1 |
| Amino Acid Sequence: | RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDV DLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI |
| Sequence Similarities: | Contains 1 FHA domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | May be inactivated by phosphorylation on Ser-199 or Ser-204 (By similarity). Phosphorylated by Lyn in vitro on Tyr-264, and also on Tyr-335 in the presence of RNA. |
| Protein Length: | Protein fragment; 28 to 127 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0192 | Human NIPA1 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0550 | Recombinant Human NIPBL, GST-tagged | Inquiry |
| PE-0551 | Recombinant Mouse NIPBL Protein | Inquiry |
| PE-2465 | Recombinant Human NIPP1 protein | Inquiry |
| PE-2622 | Recombinant Human NIPP1 protein | Inquiry |
| Related Gene / Proteins | |||
| NIP7 | NIPA1 | NIPBL | NIPP1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
