| Cat.No.: | PE-2605 |
| Product Name: | Recombinant Human RNA Helicase A protein |
| Background: | Unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability. |
| Applications: | Western blot; ELISA; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | Q08211 |
| Alternative Names: | ATP dependent RNA helicase A/ATP-dependent RNA helicase A/DDX 9 |
| Amino Acid Sequence: | MGDVKNFLYAWCGKRKMTPTYEIRAVGNKNRQKFMCEVQVEGYNYTGMGN STNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP |
| Sequence Similarities: | Belongs to the DEAD box helicase family. DEAH subfamily.Contains 2 DRBM (double-stranded RNA-binding) domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Methylated. HRMT1L2 mediated methylation of undefined Arg residues in the NTD is required for nuclear localization.May be phosphorylated by PRKDC/XRCC7. Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Protein Length: | Protein fragment; 1 to 90 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0123 | Human RNF167 Knockout Cell Line | Inquiry |
| CL-0124 | Human RNF2 Knockout Cell Line 553bp insertion | Inquiry |
| CL-0125 | Human RNF25 Knockout Cell Line | Inquiry |
| CL-0126 | Human RNF26 Knockout Cell Line | Inquiry |
| CL-0127 | Human RNF24 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| RNA Helicase A | RNA pol II | RNF103 | RNF11 |
| RNF128 | RNF133 | RNF138 | RNF141 |
| RNF167 | RNF168 | RNF181 | RNF182 |
| RNF183 | RNF2 | RNF20 | RNF207 |
| RNF208 | RNF212 | RNF213 | RNF214 More > |
| RNF215 | RNF217 | RNF219 | RNF220 |
| RNF222 | RNF223 | RNF224 | RNF24 |
| RNF25 | RNF26 | RNF31 | RNF40 |
| RNF7 | RNF8 | RNP | RNPC3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
