Cat.No.: | PE-2598 |
Product Name: | Recombinant Human SP100 protein |
Background: | May play a role in the control of gene expression. |
Applications: | ELISA; SDS-PAGE; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 36 kDa including tags |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
Accession#: | P23497 |
Alternative Names: | DKFZp686E07254/FLJ00340/FLJ34579 |
Amino Acid Sequence: | MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLY DIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN |
Sequence Similarities: | Contains 2 HMG box DNA-binding domains.Contains 1 HSR domain.Contains 1 SAND domain. |
Expression System: | Wheat germ |
Post Translational Modifications: | Sumoylated. Sumoylation depends on a functional nuclear localization signal but is not necessary for nuclear import or nuclear body targeting. |
Protein Length: | Protein fragment; 1 to 98 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0089 | Recombinant Human SP2 Cell Lysate | Inquiry |
◆ Cell Lines | ||
CL-0161 | Human SP1 Knockout Cell Line 2bp deletion | Inquiry |
CL-0169 | Human SP140L Knockout Cell Line | Inquiry |
CL-0170 | Human SP100 Knockout Cell Line 20bp deletion | Inquiry |
CL-0171 | Human SP110 Knockout Cell Line 7bp deletion | Inquiry |
Related Gene / Proteins | |||
SP1 | SP100 | SP110 | SP140 |
SP140L | SP2 | SP3 | SP6 |
SPDL1 | SPF30 | SPIN1 | SPOP |
SPT16 | SPT3 | Spt6 | SPTY2D1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools