| Cat.No.: | PE-2592 |
| Product Name: | Recombinant Human TRIM21/SS-A protein (Tagged) |
| Background: | E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2. |
| Applications: | ELISA; SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 38 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.3% Glutathione |
| Accession#: | P19474 |
| Alternative Names: | 52 kDa ribonucleoprotein autoantigen Ro/SS-A/52 kDa Ro protein/52kD Ro/SSA autoantigen |
| Tag: | GST |
| Amino Acid Sequence: | QLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQS RKHRDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADW KKTVETQK |
| Sequence Similarities: | Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Autoubiquitinated; does not lead to its proteasomal degradation. Deubiquitinated by USP4; leading to its stabilization. |
| Protein Length: | Protein fragment; 68 to 175 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0018 | Danusertib (PHA-739358) | Inquiry |
| BSM-0021 | PF-03814735 | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0107 | Recombinant Human TRIM68 293 Cell Lysate | Inquiry |
| EL-0109 | Recombinant Human TRIP4 Lysate | Inquiry |
| EL-0115 | Recombinant Human TRIM24 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| TRA2A | TRAF4 | TRAF5 | TRAF6 |
| TRAK2 | TRBP | TRDMT1 | TREX1 |
| TRF2 | TRIM11 | TRIM13 | TRIM16 |
| TRIM17 | TRIM2 | TRIM21 | trim24 |
| TRIM26 | TRIM28 | TRIM3 | TRIM33 More > |
| TRIM34 | TRIM35 | TRIM36 | TRIM37 |
| TRIM38 | TRIM39 | TRIM4 | TRIM5 |
| TRIM55 | TRIM6 | TRIM63 | TRIM66 |
| TRIM68 | TRIM8 | TRIM9 | TRIML1 |
| TRIP4 | Tristetraprolin | TRIT1 | TrkA |
| TRMT2A | TRMT44 | TRMT5 | TRMT6 |
| TROVE2 | TRUB2 | TRX1 | TRβ1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
