| Cat.No.: | PE-2591 |
| Product Name: | Recombinant Human Tristetraprolin/TTP protein |
| Background: | mRNA-binding protein involved in post-transcriptional regulation of AU-rich element (ARE)-containing mRNAs. Acts by specifically binding ARE-containing mRNAs and promoting their degradation. Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1. Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF). Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF). |
| Applications: | Western blot; SDS-PAGE; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 62 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione |
| Accession#: | P26651 |
| Alternative Names: | G0/G1 switch regulatory protein 24/G0S24/GOS24 |
| Amino Acid Sequence: | MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGV TSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTT PSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKF YLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPP PGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCC PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE AGVFAPPQPVAAPRRLPIFNRISVSE |
| Sequence Similarities: | Contains 2 C3H1-type zinc fingers. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylation by MAPKAPK2 increases its stability and binding to 14-3-3 proteins, leading to reduce its ARE affinity leading to inhibition of degradation of ARE-containing transcripts. Phosphorylated upon mitogen stimulation. |
| Protein Length: | Full length protein; 1 to 326 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0018 | Danusertib (PHA-739358) | Inquiry |
| BSM-0021 | PF-03814735 | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0107 | Recombinant Human TRIM68 293 Cell Lysate | Inquiry |
| EL-0109 | Recombinant Human TRIP4 Lysate | Inquiry |
| EL-0115 | Recombinant Human TRIM24 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| TRA2A | TRAF4 | TRAF5 | TRAF6 |
| TRAK2 | TRBP | TRDMT1 | TREX1 |
| TRF2 | TRIM11 | TRIM13 | TRIM16 |
| TRIM17 | TRIM2 | TRIM21 | trim24 |
| TRIM26 | TRIM28 | TRIM3 | TRIM33 More > |
| TRIM34 | TRIM35 | TRIM36 | TRIM37 |
| TRIM38 | TRIM39 | TRIM4 | TRIM5 |
| TRIM55 | TRIM6 | TRIM63 | TRIM66 |
| TRIM68 | TRIM8 | TRIM9 | TRIML1 |
| TRIP4 | Tristetraprolin | TRIT1 | TrkA |
| TRMT2A | TRMT44 | TRMT5 | TRMT6 |
| TROVE2 | TRUB2 | TRX1 | TRβ1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
