| Cat.No.: | PE-2590 |
| Product Name: | Recombinant Human UHRF1 protein |
| Background: | Putative E3 ubiquitin-protein ligase. May participate in methylation-dependent transcriptional regulation. Binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. Important for G1/S transition. May be involved in DNA repair and chromosomal stability. |
| Applications: | Western blot; ELISA; Peptide Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 37 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.31% Glutathione. Note: Glutathione is reduced. |
| Accession#: | Q96T88 |
| Alternative Names: | Ac2-121/AL022808/E3 ubiquitin-protein ligase UHRF1 |
| Amino Acid Sequence: | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNV CKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR |
| Sequence Similarities: | Contains 1 PHD-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.Contains 1 YDG domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated on serine residues. Phosphorylation may enhance DNA-binding activity.Ubiquitinated; which leads to proteasomal degradation. Polyubiquitination may be stimulated by DNA damage. |
| Protein Length: | Protein fragment; 694 to 793 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0011 | UHRF2 Polyclonal Antibody | Inquiry |
| EAb-0012 | UHRF1 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0044 | Recombinant Human UHRF1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0416 | Recombinant Human UHRF1 | Inquiry |
| PE-0417 | Recombinant Zebrafish UHRF1 | Inquiry |
| Related Gene / Proteins | |||
| UHRF1 | UHRF2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
