| Cat.No.: | PE-2589 |
| Product Name: | Recombinant Human v-Myb protein |
| Background: | Strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells. |
| Applications: | Western blot; SDS-PAGE; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 38 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | P10243 |
| Alternative Names: | A-Myb/AMYB/MGC120059 |
| Amino Acid Sequence: | KSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPLLEIHDNRCNL IPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQSNCEWETVVYGKTE DQLIMTEQAR |
| Sequence Similarities: | Contains 3 HTH myb-type DNA-binding domains. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 625 to 734 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0184 | MYCBP Polyclonal Antibody | Inquiry |
| EAb-0204 | c-Myb Polyclonal Antibody | Inquiry |
| EAb-0380 | MYSM1 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0344 | Human MYSM1 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| MYB | Myc | MYCBP | Myf-5 |
| Myocilin | MyoD | MYSM1 | MYST1 |
| MYST3 | Myt1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
