| Cat.No.: | PE-2586 |
| Product Name: | Recombinant Human CBX4 protein |
| Background: | E3 SUMO-protein ligase which facilitates SUMO1 conjugation by UBE2I. Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. |
| Applications: | ELISA; SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 58 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | O00257 |
| Alternative Names: | CBX 4/CBX4/Cbx4 chromobox homolog 4 (Drosophila Pc class) |
| Amino Acid Sequence: | MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILD PRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSS TDNRAKLDLGAQGKGQGHQYELNSKKHHHHAVGLNLSHVRKRCLSETHGE REPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLD EPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPA EAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV |
| Sequence Similarities: | Contains 1 chromo domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated on Thr-497 by HIPK2 upon DNA damage; which enhances E3 SUMO-protein ligase activity and promotes sumoylation on Lys-494. |
| Protein Length: | Full length protein; 1 to 290 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0053 | Human CBX5 Knockout Cell Line 2bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0146 | CBX5 Polyclonal Antibody | Inquiry |
| EAb-0148 | CBX3 Polyclonal Antibody | Inquiry |
| EAb-0150 | CBX2 Polyclonal Antibody | Inquiry |
| EAb-0153 | CBFb Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| CBFb | CBX2 | CBX3 | CBX4 |
| CBX5 | CBX6 | CBX7 | CBX8 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
