| Cat.No.: | PE-2568 |
| Product Name: | Recombinant Human BarX2 protein |
| Background: | Transcription factor. Binds optimally to the DNA consensus sequence 5'-YYTAATGRTTTTY-3'. May control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. May be involved in controlling adhesive processes in keratinizing epithelia. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | BarH like homeobox 2/BarX 2/BARX homeobox |
| Tag: | GST |
| Amino Acid Sequence: | PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKN SIPTSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAE |
| Sequence Similarities: | Belongs to the BAR homeobox family.Contains 1 homeobox DNA-binding domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 161 to 260 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0024 | Human BAP1 Knockout Cell Line 109bp insertion | Inquiry |
| CL-0030 | Human BAZ1A Knockout Cell Line 11bp deletion | Inquiry |
| CL-0031 | Human BAZ1B Knockout Cell Line 10bp deletion | Inquiry |
| CL-0032 | Human BAZ2A Knockout Cell Line 16bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0032 | Recombinant Human BAZ2B Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| BAF53A | BAP1 | BAP18 | BARD1 |
| BarX2 | BASP1 | BATZFD | BAZ1A |
| BAZ1B | BAZ2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
