Cat.No.: | PE-2546 |
Product Name: | Recombinant Human CTCF protein |
Background: | Chromatin binding factor that binds to DNA sequence specific sites. Involved in transcriptional regulation by binding to chromatin insulators and preventing interaction between promoter and nearby enhancers and silencers. Acts as transcriptional repressor binding to promoters of vertebrate MYC gene and BAG1 gene. Also binds to the PLK and PIM1 promoters. Acts as a transcriptional activator of APP. Regulates APOA1/C3/A4/A5 gene cluster and controls MHC class II gene expression. Plays an essential role in oocyte and preimplantation embryo development by activating or repressing transcription. Seems to act as tumor suppressor. Plays a critical role in the epigenetic regulation. Participates to the allele-specific gene expression at the imprinted IGF2/H19 gene locus. On the maternal allele, binding within the H19 imprinting control region (ICR) mediates maternally inherited higher-order chromatin conformation to restrict enhancer access to IGF2. Plays a critical role in gene silencing over considerable distances in the genome. Preferentially interacts with unmethylated DNA, preventing spreading of CpG methylation and maintaining methylation-free zones. Inversely, binding to target sites is prevented by CpG methylation. Plays a important role in chromatin remodeling. Can dimerize when it is bound to different DNA sequences, mediating long-range chromatin looping. Mediates interchromosomal association between IGF2/H19 and WSB1/NF1 and may direct distant DNA segments to a common transcription factory. Causes local loss of histone acetylation and gain of histone methylation in the beta-globin locus, without affecting transcription. When bound to chromatin, it provides an anchor point for nucleosomes positioning. Seems to be essential for homologous X-chromosome pairing. May participate with Tsix in establishing a regulatable epigenetic switch for X chromosome inactivation. May play a role in preventing the propagation of stable methylation at the escape genes from X- inactivation. Involved in sister chromatid cohesion. Associates with both centromeres and chromosomal arms during metaphase and required for cohesin localization to CTCF sites. Regulates asynchronous replication of IGF2/H19. |
Applications: | SDS-PAGE; HPLC |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 17 kDa |
Purity: | > 95 % SDS-PAGE. |
Species: | Human |
Formulation: | pH: 7.40; Constituent: 100% PBS |
Accession#: | P49711 |
Alternative Names: | 11 zinc finger protein/11 zinc finger transcriptional repressor/11-zinc finger protein |
Amino Acid Sequence: | MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV VQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQV VNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAES EPMI |
Sequence Similarities: | Belongs to the CTCF zinc-finger protein family.Contains 11 C2H2-type zinc fingers. |
Expression System: | E. coli |
Post Translational Modifications: | Sumoylated on Lys-74 and Lys-689; sumoylation of CTCF contributes to the repressive function of CTCF on the MYC P2 promoter. |
Protein Length: | Protein fragment; 1 to 154 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0168 | Human CTDSP1 Knockout Cell Line 26bp deletion | Inquiry |
CL-0195 | Human CTDSPL Knockout Cell Line 1bp insertion | Inquiry |
◆ Extracts & Lysates | ||
EL-0169 | Recombinant Human CTSL1 Cell Lysate | Inquiry |
EL-0204 | Recombinant Human CTCFL 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0849 | CTCF Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
CTBP | CTBP2 | CTCF | CTCFL |
CTDSP1 | CTDSPL | CtIP | ctnnb1 |
CTSL1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools