Recombinant Human DAZ1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2545
Product Name:  Recombinant Human DAZ1 protein
Background:  DAZ1 (deleted in azoospermia 1) is an RNA-binding protein that is essential in spermatogenesis. It may regulate translation of mRNAs by binding to the 3'-UTR.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  DAZ/DAZ 1/Deleted in azoospermia
Tag:  GST
Amino Acid Sequence:  SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVK IITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
Expression System:  Wheat germ
Protein Length:  Protein fragment; 21 to 120
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

  • Tel: 1-631-559-9269 / 1-516-512-3133
  • Fax: 1-631-938-8127
  • Email:
  • 45-1 Ramsey Road, Shirley, NY 11967, USA
  • Global Locations

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2025 Creative BioMart. All Rights Reserved.