Cat.No.: | PE-2537 |
Product Name: | Recombinant Human DDX41 protein |
Background: | Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | 2900024F02Rik/AA958953/ABS |
Tag: | GST |
Amino Acid Sequence: | TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDES MLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF |
Sequence Similarities: | Belongs to the DEAD box helicase family. DDX41 subfamily.Contains 1 CCHC-type zinc finger.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 523 to 622 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0055 | Phospho-DDX3X (Thr322) Polyclonal Antibody | Inquiry |
EAb-0306 | DDX43 Polyclonal Antibody | Inquiry |
EAb-0307 | DDB2 Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0057 | Recombinant Human DDX20 293 Cell Lysate | Inquiry |
◆ Synthetic Peptides | ||
SP-0178 | Human RIG-I/DDX58 peptide | Inquiry |
Related Gene / Proteins | |||
DDB2 | Ddit3 | DDX10 | DDX18 |
DDX20 | DDX28 | DDX3X | DDX41 |
DDX42 | DDX43 | DDX49 | DDX50 |
DDX58 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools