| Cat.No.: | PE-2526 |
| Product Name: | Recombinant Human ERI3 protein |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Enhanced RNAi three prime mRNA exonuclease homolog 3/ERI1 exoribonuclease 3/ERI1 exoribonuclease family member 3 |
| Tag: | GST |
| Amino Acid Sequence: | MVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQ YLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSG IDDCKNIANIMKTLAYRGFIFKQTSKPF |
| Sequence Similarities: | Contains 1 exonuclease domain. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 128 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0413 | ERG Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0421 | Human ERCC6 Knockout Cell Line 26bp deletion | Inquiry |
| CL-0422 | Human ERCC6-PGBD3 Knockout Cell Line | Inquiry |
| CL-0423 | Human ERCC6L Knockout Cell Line 2bp deletion | Inquiry |
| CL-0428 | Human ERCC8 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| ERCC6 | ERCC6L | ERCC8 | ERG |
| ERI3 | ERR-α | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
