| Cat.No.: | PE-2517 |
| Product Name: | Recombinant Human GLI4 protein |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | GLI 4/GLI Kruppel family member GLI 4/GLI Kruppel family member GLI4 |
| Tag: | GST |
| Amino Acid Sequence: | AALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVL SQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGAL |
| Sequence Similarities: | Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 7 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 2 to 100 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0192 | GLI1 Polyclonal Antibody | Inquiry |
| EAb-1974 | GLIS1 Monoclonal Antibody | Inquiry |
| EAb-1975 | GLI1 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0408 | Thielavin B | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2516 | Recombinant Human GLYR1 protein | Inquiry |
| Related Gene / Proteins | |||
| GLI1 | GLI4 | GLIS1 | GliS2 |
| Glucose-6-phosphatase | GLYR1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
