| Cat.No.: | PE-2500 |
| Product Name: | Recombinant Human hSSB1 protein |
| Background: | Single-stranded DNA (ssDNA)-binding proteins, such as hSSB1, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage. hSSB1 plays an important role in DNA damage response. It influences diverse endpoints in the cellular DNA damage response, including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. It associates with DNA lesions, and enables the efficient activation of ATM and consequent phosphorylation of downstream proteins. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 2610036N15Rik/hSSB1/LP3587 |
| Tag: | GST |
| Amino Acid Sequence: | MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSI NISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCM VYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPSAASPASENQ NGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVS NGKETRRSSKR |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 211 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0027 | Human HSPBAP1 Knockout Cell Line | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0337 | BIIB021 | Inquiry |
| ◆ Antibodies | ||
| EAb-1959 | HSC70 / HSP7C Monoclonal Antibody | Inquiry |
| EAb-1960 | HSP72 Monoclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2336 | Recombinant Human HSPBAP1 protein | Inquiry |
| Related Gene / Proteins | |||
| HSC70 | HSF4 | HSP72 | Hsp90 |
| HSPBAP1 | hSSB1 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
