| Cat.No.: | PE-2482 |
| Product Name: | Recombinant Human NAT14 protein |
| Background: | Belongs to the camello family and contains 1 N-acetyltransferase domain. Expressed in K562 cells, HeLa cells and brain. Probable acetyltransferase that binds the 5'-GGACTACAG-3' sequence of coproporphyrinogen oxidase promoter. Able to activate transcription of a reporter construct in vitro. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | K562 cell derived leucine zipper like protein 1/KLP1/N acetyltransferase 14 |
| Tag: | GST |
| Amino Acid Sequence: | MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAA ASSGLRFVLASFALALLLPVFLAVAAVKLGLRARWGSLPPPGGLGGPWVA VRGSGDVCGVLALAPGTNAGDGARVTRLSVSRWHRRRGVGRRLLAFAEAR ARAWAGGMGEPRARLVVPVAVAAWGVGGMLEGCGYQAEGGWGCLGYTLVR EFSKDL |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 206 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0040 | FK-866 HCl | Inquiry |
| BSM-0201 | Remodelin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0051 | Recombinant Human NACC2 Cell Lysate | Inquiry |
| EL-0085 | Recombinant Human NAP1L2 293 Cell Lysate | Inquiry |
| EL-0158 | Recombinant Human NASP 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| NAA38 | NAA60 | NACC2 | Nampt |
| Nanog | Nanos3 | Nap1 | NAP1L1 |
| NAP1L2 | NAP1L4 | NARG1 | NASP |
| NAT10 | NAT14 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
